DPCstruct | MC14399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3WV80 | 1-156 | MCEKLNKVNSWLSAVFGDQPVPQFEVNTRTVDLLHQLAQSSEARCSETALLTEDLRQKAAEYEAEGAHLRDVLLQGVGLSHTSLSKP… |
| A0A444FJ80 | 1-186 | METMGDLGAALDASPTSDPAAKNGAGASTDASRIAEVKAWLASQFEAAGRDVPAFEYTPRNVAHLHSLASLSQARSRAASIVAADLR… |
| A0A6P3Z3C4 | 1-179 | None |
| A0A0S7F2J9 | 1-156 | None |
| A0A7N0U4G6 | 2-164 | None |
| A0A5C6P741 | 1-156 | None |
| A0A388LPL4 | 1-183 | None |
| A0A5B7CWD6 | 21-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.