DPCstruct | MC14397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 73.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2XRD7 | 1-83 | MTRGLIWATAEDLAKNRGKVLSLYRQILRSLNSPALPLNLASRLQKKAEVRAMFMLGSEEQSIHNIQDLIDAAEYSLSILKKG |
| A0A444FES2 | 1-73 | MAKGLASTATEDLAMNRVKDLSLYHQILRNLNSPELLLTHAARLAKKAEVRSIFLFGAEERSLLNIADLIDAA |
| A0A7J7HED2 | 26-110 | None |
| A0A218XFR0 | 139-221 | None |
| A0A4Y7L2R5 | 26-85 | None |
| A0A835K762 | 37-119 | None |
| A0A5N5MNH8 | 1-73 | None |
| A0A7N2LSE8 | 1-73 | None |
| A0A834H0U1 | 145-227 | None |
| A0A072UXU1 | 51-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.