DPCstruct | MC14396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.91 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0023- PF16897- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016WPE5 | 220-314 | FREDATVDEFIDVIQGNRVYVPCIYVYNKIDQISIEEVDRLARIPHHVVISCEMNLNMDYLLEKIWEYLALVRVYTKKPGNAPDLGP… |
| A0A1I8C746 | 139-252 | LDEDLVKQILGEYRIHNADITLKYDASVDDLIDVIEGNRVYIPCIYVLNKIDQITITELDVIRKVKHCCPISAQEKWNFDELLAMIW… |
| A0A2Z7DAG6 | 570-663 | None |
| A0A3S3Q635 | 206-299 | None |
| A0A0D2XE44 | 118-195 | None |
| A0A0D7A5T6 | 162-252 | None |
| A0A5D6XKX2 | 222-314 | None |
| A0A6P5GHT3 | 210-312 | None |
| A0A2P6NHR1 | 231-330 | None |
| M5ECR4 | 221-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.