DPCstruct | MC14394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 60.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PIH4 | 10-107 | LAAVACAVLVLLAPAVSGDAATLESVPDLVKAMYVNIESFPCVRLLNLSGEIGCSNPGHGLVIAPIVRFKNSDDQLAQPSAVLLPLD… |
| A0A444F748 | 9-94 | ISSTGFHKKAMYWNIKSYPCVRLLNLSGEIGCSNPGQGKVIAPIVRFKHSNDELTRLSAVLLPLEELEGLLLRYDYDKFLLSAYSF |
| A0A0A0LBP2 | 6-101 | None |
| A0A1D6M5G1 | 258-346 | None |
| A0A1D6FHR1 | 2-90 | None |
| A0A2G3AZV2 | 18-116 | None |
| A0A804QM30 | 4-104 | None |
| A0A2P2M6L0 | 26-107 | None |
| A0A7J7LPY1 | 50-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.