DPCstruct | MC14393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444C5C0 | 105-195 | TLTAAISFAREERLNQYVRRTRPTPRPVAYKLPSTSNRPPQPKKLTREELRDRSAKGLCWHCDESWSRDHRCKKGRLLLIELADESE… |
| A0A444F3X2 | 1-105 | MAAISFTRIQEEWLNTNARRTKITTRPATSRPSASLATNRSYQPKKLTRDELSERSAKGLCWHCGEQWSHDHRCKKGRLLVIEPIED… |
| A0A426ZZW5 | 80-180 | None |
| A0A445MKV1 | 74-168 | None |
| A0A445MGJ6 | 45-131 | None |
| A0A426Z1K8 | 1-96 | None |
| A0A427AAG3 | 9-109 | None |
| A0A426YM57 | 43-121 | None |
| A0A444EI37 | 64-164 | None |
| A0A438FP95 | 17-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.