DPCstruct | MC14392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 62 ± 1 aa |
| Standard deviation of domain lengths | 0.99 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 93.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 53.61 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351PWA5 | 72-133 | AVVISMMPPGMHYLVAKDCVHYKKHLLTASYLDDKIKTLQHQIESSNILFLCEMGLDPGIDH |
| A0A0S7FUC9 | 293-354 | DLVISMLPYSFHPIIAKHCIRRKVNMVTASYLSPAMRELQSSVEEAGITIVNEMGLDPGIDH |
| A0A369J050 | 161-222 | None |
| A0A2K5F5N5 | 540-601 | None |
| A0A7R9KI11 | 36-99 | None |
| F4PVT8 | 302-363 | None |
| A0A177W964 | 70-133 | None |
| A0A7J7LBB2 | 513-572 | None |
| A0A482SU31 | 654-715 | None |
| A0A6A5VFB8 | 90-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.