DPCstruct | MC14388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380TGJ5 | 21-115 | EAGSNPRTLTLEWRTGKRRTLPWARLIDATLEDGELLLSFTGREVTFYGLILGGLLDAVVEYRLEKVWELPADYRPSADLKRPCVSK… |
| A0A257TMK6 | 20-124 | EKADCLEVRFKSGNSTWLPYNWFGSWKFDPSHGLLLKFSGDVVYLVLVTGSNLDRPLLDTTTNLTTSGLQRRRIVWIREMTEEEIRQ… |
| A0A7R8QH63 | 23-107 | None |
| A0A3N9MP41 | 10-96 | None |
| A0A426CMH2 | 1-131 | None |
| A0A2V5WVX0 | 5-130 | None |
| A0A6C2YVB9 | 32-134 | None |
| A0A225NAE2 | 49-151 | None |
| A0A3S2V8T6 | 16-125 | None |
| A0A5M6CYB4 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.