DPCstruct | MC14386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G9JQX8 | 7-76 | ISLINKERTTTWFEKQTGIDRYRWQNIKNGKVRLSDAEIDAVVVLFPQYAYWLISGKTAPEIGQISPEQE |
| A0A1I0UKH4 | 1-77 | MIKSRVIEILKTSEMRLPELEERTGINRYTWNNLKNPSRNREIKESEILAIAELFPQYRWWLLTGEVMPEIGQTSPA |
| A0A6M8SRI3 | 4-80 | None |
| A0A5H2YXV7 | 1-92 | None |
| A0A7W7KNL6 | 4-83 | None |
| A0A3N8RQ67 | 7-81 | None |
| A0A2V3R314 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.