DPCstruct | MC14380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167U5E7 | 7-103 | WSILITEGEVEPWYFLDGWEKQIKEQKQFANSKEAMAQYKALVEAHRQRFDHYQIKGSSIACFWNDGEEVYCEACDEFLQVYHGILL… |
| A0A1X6WQQ8 | 2-103 | YQVIVTYSENEPWWFFDEWQEDIQTEEAFDCFCSAKKRFDQLATEYQSEFELDKIKPPLLAAFWNDGDLIYCEDCDEELQAYKGLLL… |
| A0A3L7JXG4 | 30-133 | None |
| A0A2X3VD54 | 2-110 | None |
| A0A1L7LHH1 | 1-94 | None |
| A0A4Q1B8F5 | 2-94 | None |
| A0A139NEH5 | 39-146 | None |
| A0A396S9U1 | 38-129 | None |
| A0A378MA06 | 4-113 | None |
| A0A2R5HJX1 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.