DPCstruct | MC1438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.70 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644SMU5 | 43-142 | PTLTDEIAFQLSEKPVHCINQEYPNKTAHVINNEMDVKLSPKELHPSFYGCFDWHSSVHGHWMLIKLLKDKPFLKNKEEIIKILDGS… |
| A0A090PGD8 | 22-121 | ATPQLHLDQANNLAALPLHCIETEYPNKMGGHVTAAPEDQKRPTDQHPVFYGCFDWHSAVHGYWSAVTLIKQFPKLEAREELLAKIK… |
| A0A815Z5Y6 | 2-92 | None |
| A0A542TI76 | 1-82 | None |
| A0A821TWM0 | 19-132 | None |
| A0A257U7G4 | 15-125 | None |
| A0A7X1P4F1 | 1-101 | None |
| A0A853CN79 | 1-101 | None |
| A0A2N2GPX3 | 19-142 | None |
| A0A7X3NHK5 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.