DPCstruct | MC14377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 296 ± 25 aa |
| Standard deviation of domain lengths | 25.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4DEA3 | 170-432 | FMGVDVGPGGNAMRMDEKDDFSGVKNRFEEYRELYANGGSLSASETFEFFEQTNLINDKSSFPSLKKFTKDLFLIEDRGQEALRSPE… |
| K2F2H6 | 3-311 | PWLVDRTLRNILIDATGNTHRSEISIDKMYSPDSATGRLGLLELRAFEMPPHPHMSSVQQLLLRALIARFWKTPYRAPATRWGTELH… |
| A0A7W0ZSQ6 | 27-328 | None |
| A0A7W0Y3N6 | 1-237 | None |
| A0A1H5DLU1 | 486-782 | None |
| A0A0S8BSD7 | 449-752 | None |
| A0A7V9L3H8 | 255-553 | None |
| S4XJX2 | 819-1125 | None |
| A0A7V2G4K5 | 396-671 | None |
| A0A1L6L737 | 2-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.