DPCstruct | MC14374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 4 aa |
| Standard deviation of domain lengths | 4.47 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 69.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I9RFR2 | 72-155 | DKSLKDVIRDKQELKKKIGKLQDKQNKSPKELSLLGRLEFLQRNQDKAKDYKKTIKDLQNPQQASNANKNNTDDNKKKKLTKKN |
| A0A826F0Q7 | 1-97 | SLKDVITDKDGLKEKIKELQRKPETNEKLNLLGRLEFLQRNQDKAKDYKKTIKDLQNPQQASNDKQNDKTKSRTKNKQKQTTTPNQE… |
| A0A824D906 | 30-110 | None |
| A0A7U9YUC1 | 291-377 | None |
| A0A6W1ZIK6 | 1-87 | None |
| A0A826GQE2 | 244-326 | None |
| A0A825LPU7 | 58-139 | None |
| A0A825EAF2 | 94-177 | None |
| A0A825EAC6 | 83-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.