DPCstruct | MC14372
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 178 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A825X0M3 | 1-193 | MEQILKILKQMLSPDQAQILLKALKNSNNENFYNFALENIEIICEWLNSKEFQENYTNHPYPPLLNPNYIDTDASRHCAELAWDLNL… |
| A0A825G7B8 | 157-339 | KNILKIHQDYRAILDNIFHNFNYFIQNFDLIEEWLLSDDFKERYKKENHPYPSLLDPKKLNDKNEKINYHNIPAELAWEMNLPLPDN… |
| A0A824AB44 | 1-195 | None |
| A0A823U6T1 | 127-306 | None |
| A0A7I9U572 | 58-240 | None |
| A0A0A8HWL3 | 150-329 | None |
| A0A2U8FC03 | 379-572 | None |
| A0A824APP1 | 3-148 | None |
| A0A268TKD1 | 3-158 | None |
| A0A824EC02 | 3-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.