DPCstruct | MC1437
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.76 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A362X4S6 | 121-178 | VVDMLYFPMYKGYLPEWIPKYGGKFFTFFEPVFNIADMAISTGFMMLIVFNKRAFAKD |
| A0A090PFE7 | 1-56 | MLYFPLFDGTWPAWIPWIGGETFSFFNAIFNVADSAITIGVILLILFSKKAFPEKS |
| A0A2D9J405 | 1-62 | None |
| A0A7K3IZJ9 | 18-76 | None |
| A0A3R8NML1 | 86-143 | None |
| A0A2D5K544 | 94-148 | None |
| A0A645E6D6 | 50-113 | None |
| A0A7Y2MNS8 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.