DPCstruct | MC1436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.05 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF03900- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0VGX5 | 120-191 | DILIGAKKTVLNADAYTEGYVTIPFPLGDVPREMGVCTDVVIRAVRNAGVDLQKALYDDIKRAPKAYPMVKG |
| A0A090PEW7 | 2-104 | LFKKLLLTAFLLIPFAGICQTTFGWQLAHAAGELTNDDVVYNGAYFSIDYPGGDVPSGYGVCTDVIIRAYRAVDIGLQKEIHEDMKK… |
| G9QSS1 | 3-89 | None |
| A0A7X9D764 | 213-296 | None |
| A0A7C8D8C5 | 7-87 | None |
| A0A538PX53 | 468-543 | None |
| X0R0X6 | 9-111 | None |
| W4P6G7 | 17-91 | None |
| J5NRJ1 | 3-74 | None |
| A0A3N2RIV1 | 51-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.