DPCstruct | MC14359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 96 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9WS93 | 73-172 | RSEPAPAPQSQESAPAPAASSGGSGVWDQIAQCESGGSWSTNTGNGYYGGLQFSQSSWEAVGGSGRADQASREEQIARAEQLKAQQG… |
| A0A6G2JZ28 | 110-185 | TPAQWEALRQCESSGNYLVNTGNGYFGAYQFDQPTWESVGGSGRPHWAEPVVQDARARLLFARRGWQPWPICGRHL |
| A0A358SUJ9 | 96-198 | None |
| A0A7W0P9C3 | 387-496 | None |
| A0A2W4Q3T2 | 396-484 | None |
| A0A6G3V4A8 | 1-65 | None |
| A0A4Y9M9Q2 | 41-135 | None |
| A0A7K0PJA1 | 113-209 | None |
| A0A0K3BWB5 | 5-88 | None |
| A0A1A3J5E9 | 6-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.