DPCstruct | MC14357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 348 |
|---|---|
| Mean domain length (aa) | 364 ± 93 aa |
| Standard deviation of domain lengths | 93.37 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5C9V8 | 2-253 | AISRMFNFEWSNETLFYGLYARVTGFATNSYNEATGKPSPEELAVLEPLADILPEGVLTDEVVMPPVSGTRQLDRKQLRAASALLDE… |
| A0A7J9WG28 | 259-637 | RGAVALDRTTLEVSLSRPVQDFPSMVAHPALAPMPEVSKSQLEHPVGNGAFGMAEPWARGRFVRLRRHRPAPTRRGIGAAVDEVVFR… |
| A0A4Q2A1W1 | 176-397 | None |
| A0A1Q9SX53 | 35-408 | None |
| A0A1Q9SN32 | 36-339 | None |
| A0A7Y0Q2B4 | 28-382 | None |
| A0A135Z699 | 8-218 | None |
| A0A812YJB7 | 454-941 | None |
| A0A2V7WQD5 | 153-528 | None |
| A0A1W9HIZ5 | 3-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.