DPCstruct | MC14356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 235 ± 35 aa |
| Standard deviation of domain lengths | 35.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9WG14 | 1-215 | MSDDRPLEPPTPVAVNSPSARHIGVAVRHGVRLGAAGLLAGVAAGAVAGLGARVAMLLVRLMNPAYNGIVTHAGYEVGQVTVGGTVA… |
| A0A536AMS9 | 4-249 | GSVTIARARFDLEAVARAVGAAGIAGVLVGVPAGLLSRVVMKVSALAAGPTVAGHLTENGAVVGALTAEGTLFLVLFAGLVPALSAA… |
| A0A7V9V9F0 | 2-189 | None |
| A0A7J5UV43 | 1-225 | None |
| A0A6J4UGM3 | 1-251 | None |
| A0A1Q7HKK3 | 2-196 | None |
| A0A7W0PM63 | 87-354 | None |
| A0A0U3RDP8 | 31-284 | None |
| A0A4U0H3V2 | 42-325 | None |
| A0A3A0AGX7 | 91-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.