DPCstruct | MC14355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 319 |
|---|---|
| Mean domain length (aa) | 170 ± 35 aa |
| Standard deviation of domain lengths | 35.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 98.79 |
| Assigned Pfam label(s) | PF03793- CL0159- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4MT98 | 4-141 | GPRTVTVPDVRRLTRAEAENQLLQLGLRVGAVTEVFAQDVDAGRVAEQSPPPGTQVQEGSVVDLKISRGTRRVPNLVGRTLAEAPAQ… |
| A0A7J9WC22 | 102-265 | VADRSYLKGTQPTEVCREPTGPPTQDVPSVVGLPLHAASRLLEDAGLRVRRRAAVSATLPPGYVIRQDPDAGRAQRLRGGYRVTIWV… |
| A0A1V8QFI3 | 144-384 | None |
| A0A2N5YPZ1 | 6-126 | None |
| A0A7J9TVW9 | 53-212 | None |
| A0A6G2HDI9 | 97-245 | None |
| A0A350MV85 | 13-197 | None |
| A0A7W0P420 | 90-241 | None |
| A0A556MNJ3 | 148-302 | None |
| A0A0X3QJJ6 | 563-743 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.