DPCstruct | MC14354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 233 ± 64 aa |
| Standard deviation of domain lengths | 64.10 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.40 |
| Pfam Score | 50.83 |
| Assigned Pfam label(s) | PF19290- PF19289- PF01523- CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9W8U3 | 110-317 | VLAAALSAGAEFAEVYAEQRRSRTVRLDDRRIESLTSGRDRGAGIRVQRGAQTAYAYTNVLSRHALLDAARVAAAGVQGSSETSVAD… |
| A0A3R6AYM2 | 3-210 | EKILQAIRQFQIETYLVTEKTVEGAELYFIKKELDMRRMKQDAVSAVTIYRDFETDGKKMRGSANINIFPEMTQEEVDEAVKGAYYA… |
| M6YAD6 | 426-675 | None |
| A0A7C7VGQ2 | 79-410 | None |
| A0A5C6TZX4 | 6-255 | None |
| A0A430EF27 | 13-204 | None |
| A0A7E4SGM3 | 789-1052 | None |
| A0A6J4HAS7 | 6-174 | None |
| A0A2V9GGL0 | 44-303 | None |
| T2RF53 | 6-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.