DPCstruct | MC14353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 179 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1GND3 | 1-152 | MAAPPASAAVPEHFSFAFGPEEDPAFATCDGFNIALSTAGRVSGTVLFDDAGEPYRFIVHTRLRDTLVNSVTGTTVVNRGVFTEIYT… |
| A0A7J9W8P9 | 1-212 | MSHRSARRRRALLGLVLGAVLLVQASGPAATALAATQGAQNGREPLLREQIDDRFVEEPDLFVLEVCGLEVRVQGRIRGHFVLYGDL… |
| A0A538GU36 | 1-189 | None |
| A0A538A2L0 | 1-176 | None |
| A0A4Y9Q7D3 | 1-146 | None |
| A0A543PUQ6 | 14-219 | None |
| A0A1F8S452 | 1-181 | None |
| A0A535CDD6 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.