DPCstruct | MC14352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 268 ± 54 aa |
| Standard deviation of domain lengths | 53.59 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561UWJ9 | 9-208 | VAALYAADHLGKRDASLATVLATVIEPEHVPYLSVLRYKETGLRKRAQWEQVWEQRREEDRNGLRLDIAVPPKYSGADFLKHSYWSN… |
| A0A846AA59 | 43-307 | NDAGEVNAQIPEPALISTAKLADIARQDPDFLQVGELYTHDAAFDVLKLVNTLVEAESVPLIPILRYKPSGLRKRQDWEHTWQLQRQ… |
| A0A2U2AZJ2 | 551-819 | None |
| A0A0F9QC86 | 577-972 | None |
| A0A1I5IZP9 | 35-307 | None |
| A0A1C4I5K5 | 348-614 | None |
| A0A1Y3LEN5 | 2-246 | None |
| A0A847KK71 | 1-165 | None |
| A0A1S2KGA4 | 9-241 | None |
| H1G679 | 96-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.