DPCstruct | MC14351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 239 ± 35 aa |
| Standard deviation of domain lengths | 34.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0ADU6 | 2-160 | QDFLEQGLIEVLDHAIGQALVEHIASLEQSRRYACFASKVIPGFRFLYCEGKSLKEIATLLNMTNHSQASRVLAPGKLLNHVQYLSV… |
| A0A846A9L5 | 5-232 | RGSRCQTPTETQLSRIEGTRSTRAVLLQLQAIASLLRQYRIHVRSHAWQTESIEASNIEWPASTATEAELAQEVFLSQYRQVLVTCL… |
| A0A846B998 | 142-398 | None |
| A0A844M5H9 | 189-443 | None |
| A0A350Y6J2 | 2-218 | None |
| A0A6M0RR33 | 277-546 | None |
| A0A6B3P5B2 | 86-319 | None |
| A0A6P0X745 | 84-344 | None |
| A0A6N2DEE3 | 33-265 | None |
| A0A6P0SR80 | 41-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.