DPCstruct | MC14347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 185 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 17.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846A7D5 | 87-255 | DTDCESPETQLEMNQCAKAWYSQEDAKLNQVYNQVKSGLSSSRQAQLTDAELAWIDFRDANCEFEANQYEGGSIQPTIYYGCLAQVT… |
| A0A420GYM3 | 97-301 | MDGRVQHLARLRAEGWTGNNFSVCDDATSGLLAGICEAHASRIENIRRKQTITALSKDWSAPQKAALARLQTASATYANAVADNEVD… |
| A0A6J7ZCK7 | 29-214 | None |
| A0A2W7N0X2 | 178-364 | None |
| A0A157ZKD3 | 25-189 | None |
| A0A6M0FFU4 | 191-375 | None |
| A0A845XB58 | 3-178 | None |
| A0A251W9W9 | 2-156 | None |
| A0A1Z4KD10 | 49-227 | None |
| A0A5E4ZLE7 | 20-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.