DPCstruct | MC14346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6K5B5 | 203-318 | WTLLGMASVDNLEDVIGGHIWIGLILIFGGIWHILVPPFTWVRKILPIDNGEEILSYSLLGLALMGFISAVFVGYNETVYPKEFYGD… |
| A0A846A6S2 | 1-134 | YVGFLLIAGGVWHILVPPLKWAKRVLIFSGEAILSYSLGGIALAGFVAAYFCAVNTLAYPTEFYGPPLAVKLGITPYFADTISLPLG… |
| T2JU15 | 1-106 | None |
| A0A845Y8Q8 | 196-347 | None |
| Q9L8M2 | 202-360 | None |
| A0A3N6PHH4 | 615-747 | None |
| A0A0A2BRD0 | 137-294 | None |
| A0A6P0S0A1 | 207-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.