DPCstruct | MC14345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 233 ± 27 aa |
| Standard deviation of domain lengths | 26.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1GIX5 | 141-361 | ETNLSHYLTYQVRRSRIKAQLGRDAANNLPAVTNPTLLSTKELGMAFGQFAGKAEGNSSYRDLSRGFVSQLEMQPIIKTFKGDLYDY… |
| A0A845ZV30 | 6-225 | SHYVTYRVRRSRLRRQGKATAAEQTLRPIENPTLLSDRDLVMSLRQFTGRVEASGSYRDVAQRFKSQHCQITQKFGAFKDDLYEYVT… |
| A0A6P2AYQ4 | 257-507 | None |
| A0A1Z4USD7 | 3-190 | None |
| A0A6M0F7V9 | 75-314 | None |
| A0A522XGL5 | 138-418 | None |
| A0A3M1SUH1 | 10-264 | None |
| A0A1Q4R0W9 | 13-233 | None |
| A0A372DCW6 | 237-449 | None |
| A0A6P0Y0Z0 | 5-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.