DPCstruct | MC14344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08865 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1I8S4 | 1-63 | MNSYSYRNESNRMIIFKCMAKDFWLEKVVMPFETYIFDAPDNADVEIFGLDQQLARHYRIEEL |
| A0A845ZUZ8 | 1-74 | MVIEKITCYYFNASSQIRVVRIANVSDWYFERILFPGQRLMFEAPAEAQLEVYANAVLVEEIACRQLEVQSSET |
| A0A182AMK2 | 1-74 | None |
| B4VSV4 | 13-89 | None |
| A8ZNW8 | 9-82 | None |
| A0A6P0TJW1 | 8-89 | None |
| A0A6N2EIB1 | 9-97 | None |
| A0A2T1DK93 | 1-63 | None |
| A0A0P4UWN3 | 3-80 | None |
| B0JMN5 | 26-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.