DPCstruct | MC1434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 359 ± 31 aa |
| Standard deviation of domain lengths | 31.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.63 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0105- PF11827 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5W8K4 | 2-312 | DKKGDKVSFSVASIPGETFEGTISFLDPVIDPKTRVAKARIDMANNGLKLKPEMFASGTVEAKLSAKAGNLSVPKTAVMWTGKRSLV… |
| A0A081DBZ7 | 1-346 | MAAEGDYVKQGQPILRVSNLNSVWAEFDAYENQISQFKKGQKIKVSTNAYANKEFDATVSFIDPVLNNATRTVTVRATLSNNDDLFK… |
| A0A7X7QWM5 | 1-376 | None |
| A0A3C1HFC4 | 177-532 | None |
| A0A1G3AN10 | 238-542 | None |
| A6DK98 | 245-633 | None |
| A0A3M1B3N9 | 334-733 | None |
| A0A7M3MX63 | 228-572 | None |
| A0A7V0MIT5 | 138-457 | None |
| A0A7W0K964 | 22-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.