DPCstruct | MC14338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078B3S1 | 105-194 | AFVVGYDTYIRLIDIKYYMYSIQELERVLSIFKNTGTSILVAGRLNQSTNLFEYLDELSIRSVSEQYRDIFQPIKEFRVDISSTELR… |
| A0A7X3VD42 | 1-84 | MTRLVDPSYYGDSPQRMNAALSELRDLRCDFLIAGRVEGGSFKTLEDLPIPPDYAEMFTQIPESAFREDISSTELRRQLHRLPE |
| M8AL71 | 461-547 | None |
| A0A2U1NI52 | 309-386 | None |
| A0A6A5LJB0 | 947-1020 | None |
| A0A7S1GM38 | 1-99 | None |
| A0A2J8A3R2 | 410-504 | None |
| A0A7J6XCY9 | 296-382 | None |
| D2VEZ0 | 326-411 | None |
| A0A2V6PZW7 | 176-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.