DPCstruct | MC14334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 10.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6I8G3 | 1-90 | MPVTFQQVINLFVDGATEGYSGTKTNQGNLKIKGEQLIHYNTPIAERYGDMFILNTTRYSLQTGQLQKKIKATIPEEKRIDVKRVPS… |
| A0A7X9C6S3 | 1-85 | MRNNDLIDGYLNGMDTGSNWTKNLHIKGPALINYSTIIALRTPRGLLVNTTKYSPTTSKHQNRLLRKGTNVIEVTEEEIKEAFNN |
| A0A441BSH3 | 1-72 | None |
| A0A843GT11 | 1-71 | None |
| A0A355JD76 | 13-86 | None |
| A0A350SJR3 | 1-72 | None |
| A0A0F9U8Y4 | 171-271 | None |
| A0A2E8A834 | 20-105 | None |
| A0A3N5P772 | 3-90 | None |
| A0A532V149 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.