DPCstruct | MC14331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 248 |
|---|---|
| Mean domain length (aa) | 140 ± 29 aa |
| Standard deviation of domain lengths | 29.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.30 |
| Pfam Score | 55.56 |
| Assigned Pfam label(s) | PF07553- PF02631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9ERZ4 | 189-283 | GTVAQQNAKRSAEDYLAFTAFSRSGLIGQLEFEGFSTEDATWGVDHLTVDWNEQAAKSAAQYLDFTSFSRSGLIEQLIFEGFTPEQA… |
| A0A7X9C1K5 | 194-332 | SREQKNALQKAKDYLNYSSFSKVGLYDQLIYEQFPNDAVQFAIDHIEVDWHDQAFQKGNDYLEYSAFSYQGLYDQLAYEGFENNEIQ… |
| A0A1Y6ENT1 | 2-142 | None |
| H1LGR0 | 5-157 | None |
| A0A1T4LWC2 | 44-196 | None |
| A0A323VC90 | 3-79 | None |
| A0A1R4G3S6 | 2-151 | None |
| A0A4V2MM57 | 10-193 | None |
| A0A150NRA5 | 40-147 | None |
| A0A5N9BT66 | 28-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.