DPCstruct | MC14330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 249 ± 23 aa |
| Standard deviation of domain lengths | 23.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FRQ1 | 9-234 | GLSYVDFIPERLEGGGFFSAFTVLMARGNEWLAKNADWEAVTCESMEFKTTDRVQAEKMTYYESGERHTAYVRCLRLWVRRRNNLDE… |
| A0A7R9GKA2 | 21-273 | LAQQNHSDGVQKLKCLNVLPRCSYRTGYENLSHLVKRANNWLRHHKQWEVRTCESLPLQTKAGRNKIAGPVTLTQLSRMRRSAPDTC… |
| T1FGI5 | 1-237 | None |
| T1F287 | 143-391 | None |
| C3ZTB3 | 5-248 | None |
| R7TJ12 | 48-275 | None |
| A0A7I8VWC4 | 29-291 | None |
| T1JS27 | 19-277 | None |
| F6Y0R0 | 273-513 | None |
| A0A7R9QG43 | 133-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.