DPCstruct | MC1433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9ASW3 | 1-69 | MINATELFGRKLDGYCIRCKEKIPFNRYRPLCYNDWQDWVRWKNPLYIERYCHKCGEPYMATKSQPLCD |
| A0A081DB56 | 1-86 | MWGTKHNTENQQKVGYCIRTGVEIDYNPKRPMSYDAYKVWVEYANFDFNESYCHQTGERSGKKTSMRRPILNSNYENKETIIGRFL |
| A0A356JXU8 | 221-289 | None |
| A0A7T9GR19 | 66-137 | None |
| A0A4Q5ZV06 | 431-496 | None |
| A0A3A5G1Q6 | 258-320 | None |
| A0A516GSE8 | 114-183 | None |
| A0A5R8WM50 | 156-228 | None |
| A0A1I5GT92 | 221-294 | None |
| A0A849PV58 | 72-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.