DPCstruct | MC14329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 218 ± 38 aa |
| Standard deviation of domain lengths | 38.46 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9GGC9 | 13-202 | MDHRRHLPRAYKLATLAMKNVHLAYNQESHPAINDIHWACVLSHSLGKQELANLVPLLVKNVQCATVLSDILRRCSMTAPGMAASPS… |
| A0A653CCC1 | 154-340 | RPHHQFNQAQLRYLLTAYRVGMLALETLARRVHDDRPQAKYARNPPYGEDVKWLLRISKHLGSQYLHHFCVCAVNSIVSPFVLHDVA… |
| A0A183QP72 | 12-332 | None |
| A0A182U5P2 | 232-419 | None |
| A0A5S6PZX7 | 767-1001 | None |
| A0A5N3VTR8 | 744-938 | None |
| A0A0R3UF25 | 3-267 | None |
| A0A6V7WDB0 | 428-679 | None |
| A0A811W4I4 | 385-627 | None |
| G3ND25 | 316-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.