DPCstruct | MC14323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 371 ± 48 aa |
| Standard deviation of domain lengths | 48.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A854LUC8 | 1-314 | MTVDPADLNQDGKVTKKEKKRYENQKRKEFQNMWAISYALIEQDQQLLEWFNGQTEEYLANPEGFSKEAFFLELDQQPFSQKYSSVA… |
| A0A2D7UYJ8 | 12-376 | EGSTDLYLVDGEYYRTGKDSFGVSTYVQQLVGRPSDPEVPIQMNAQEFSNISRGWTWLDKAQTPGADLRAFMPSVDSLIVNLGPLAA… |
| A0A3R7TMA5 | 315-743 | None |
| A0A838Q8D1 | 102-474 | None |
| A0A345HWS7 | 127-429 | None |
| A0A2D8EVY7 | 110-494 | None |
| A0A1V2RD43 | 125-427 | None |
| A0A6M3XRF2 | 1-396 | None |
| A0A3D1DI36 | 252-702 | None |
| A0A661D0X9 | 58-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.