DPCstruct | MC14320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 11.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8EJ11 | 127-202 | ESLEMTAERTIPYFVEEIIPDLESGKNVLVAAHGNSLRSIVMRIEGISPEDITSLEIPTGVPMHYEFANGEISRIG |
| A0A330LEW5 | 8-74 | FWKDEIVSKLIDGQNIIVAAHGNSLRALTKYIENISDEDIMDVEMATGEPVVYDLDENLNVVSKKKL |
| A0A7S4NRF8 | 9-103 | None |
| A0A4U1FKB0 | 60-138 | None |
| A0A6U5NHX7 | 2-100 | None |
| A0A7G8W9T2 | 6-67 | None |
| A0A4U0W3N2 | 448-528 | None |
| A0A2T7PCD6 | 83-164 | None |
| A0A7R9YJC6 | 13-93 | None |
| A0A7S4EE24 | 104-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.