DPCstruct | MC1432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2IWR4 | 134-252 | MRFAPYPPIWMTFVLGVAIYINFFAHHFLPDIRIALFIATVVLFARTRVWFRIDGSAYWMPMPISAFLAAGFLWIAENIGTATGTWI… |
| A0A1C9BWL4 | 10-122 | AVPLGAMIYFNFFTHHFTYDFRWILTLLLFIVFSRTFVQFSLQGVTYKMPLVLSFFLIGFFIWIAENIATFFGAWQYPNQREAWSLV… |
| A0A1C5J6Y0 | 11-131 | None |
| A0A2H0BE42 | 1-92 | None |
| A0A0N1HCH2 | 164-290 | None |
| A0A849F872 | 61-176 | None |
| A0A679ISS7 | 34-168 | None |
| A0A3B9EF97 | 76-191 | None |
| A0A358H288 | 11-123 | None |
| A0A521H242 | 139-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.