DPCstruct | MC14319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 24.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 88.63 |
| Assigned Pfam label(s) | CL0039- CL0063- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258HSD0 | 40-200 | DPWAPLNLNDPPGWATQRKLAQLVNEGRVRGWDDPRLPTLAGLRRRGYTPSAIRLFAERIGASKSDSWIDYASLEGCLRDDLEHSAP… |
| A0A7G2ILH0 | 78-235 | RRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRGYTAAAIREFCKRIGVTKQDNTIE… |
| A0A654GVP6 | 399-550 | None |
| A0A2P8ZA14 | 58-209 | None |
| K7I6I4 | 415-535 | None |
| S3CKI6 | 715-873 | None |
| A0A835HG18 | 59-192 | None |
| A0A6J5VQP7 | 77-233 | None |
| A0A485JLE9 | 6-186 | None |
| A0A167KSB0 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.