DPCstruct | MC14318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 321 ± 60 aa |
| Standard deviation of domain lengths | 59.92 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A258H799 | 1-358 | MHLRVLDEHGRQLGQGRSLAALKAELGAQARGAFQALAGLQLALRAGEGAAPASTPASAPASAPARMQVVQAVPAAPAPQAASERHR… |
| W7QJP0 | 11-268 | AYPALVPDGDAFRIELFDHPGKAERAHRLGVARLAMARLPDQVKAIERLPGLNTCALLFAKVGSKRQLNEDVVEAVFTQVLTTSPLP… |
| A0A7X9CCY8 | 74-400 | None |
| A0A0D9L7Z0 | 230-547 | None |
| A0A7Y6SL20 | 59-391 | None |
| A0A7V7N3I8 | 183-556 | None |
| A0A257VXG7 | 78-403 | None |
| A0A660SM27 | 35-325 | None |
| A0A2N7QDF6 | 2-297 | None |
| A0A1J5Q4P9 | 2-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.