DPCstruct | MC14317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 63.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0492 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3I4N0 | 4-75 | VSFYRNYGKTFKKPRRPYEKERLDAELRLVGEYGLRCKRELWRVQYALSRIRNAARELLTLDEKNPRRIFEG |
| A0A2K5JE20 | 6-79 | TPVARSWVCRKTYMTPRRPFEKSRLDQELKLIGECGLRNKREVWRVRFTLATIREATRELLTLDEKDPRGEAEG |
| A0A0D9XTW7 | 225-294 | None |
| X6LNT3 | 104-175 | None |
| A0A836CQL1 | 1-77 | None |
| A0A6A6MEK1 | 25-100 | None |
| A0A2A6B719 | 54-120 | None |
| A0A812VKS4 | 1-74 | None |
| A0A1I8HPE0 | 2-76 | None |
| A0A7J6KUK5 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.