DPCstruct | MC14316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 210 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679JYN1 | 3-196 | RFTKDEMRDELRTIFLYEADHIMLGRGSEMATAFIGFPDDDSGEYIDMSPSLVDLSRFDIASVFDRCFDYAFNPSPLNASDGSEVQD… |
| A0A562ZT15 | 1-235 | MNRQAVLDEIAAFQEGFKLSIRRLYGTTLGLPDELDHEATPLYRTVAAMFDYGVAGQHKPDSWLGQGDLLNPDFCDVEAFLSGLAGL… |
| C4ZID4 | 17-263 | None |
| A0A2T5PMW9 | 1-220 | None |
| A0A418RJ68 | 8-194 | None |
| A0A6B3SR60 | 69-291 | None |
| A0A7W4I7F9 | 55-252 | None |
| A0A0B8PUJ2 | 19-237 | None |
| A0A7W8HIH0 | 1-221 | None |
| A0A2S5QWJ7 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.