DPCstruct | MC14314
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255T9S2 | 1-97 | MRLLLNVVKKALPIANPDFEEAIQNVTTWYVEYDDTVYNHVLREIGQDAKNNIIVKMPDERNRGFWADSDFDLSVYASFNLTYISKI… |
| A0A562ZGZ5 | 1-106 | MRTIAISLDKSGQSRLRAHPLLEQVLRTMVPSASPDFEKAYSDVRHWWIEVDETGLPQREIGFSISEQAIVAGPLGRNMGFWTDSPM… |
| A0A2W1JUT6 | 1-104 | None |
| A0A2N6QRL3 | 9-98 | None |
| A0A2S1SKG4 | 21-133 | None |
| A0A380ZTN9 | 1-95 | None |
| A0A352RBE4 | 3-123 | None |
| A0A098LKA9 | 1-100 | None |
| A0A133Y0J8 | 1-134 | None |
| A0A258JSX9 | 4-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.