DPCstruct | MC14312
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 204 ± 21 aa |
| Standard deviation of domain lengths | 21.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02570 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484F7V9 | 10-247 | EISISEIYDRLQHVPMPMPKKEKKPEEFKELHDEVNENRVRKACTEVSGDIDYKRLLVFKTHPVAAALKAFRNDSVIYVDTPLMRAA… |
| A0A6N7YL10 | 6-203 | KDGPEIYRRSFATIRDEADVAILPEDLEPVAVRMIHSCGMVDLVDDLAYSLEVVESARDALRAGAPVLCDAHMIASGITRRRLPADN… |
| A0A378AI74 | 117-331 | None |
| A0A2S4MEN0 | 431-637 | None |
| A0A1I3L534 | 320-531 | None |
| A0A1I3RFH1 | 297-510 | None |
| A0A7J5GUX6 | 112-325 | None |
| A0A7J3NV31 | 2-159 | None |
| A0A521KGZ9 | 6-207 | None |
| A0A7W0FEL6 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.