DPCstruct | MC14311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 510 |
|---|---|
| Mean domain length (aa) | 300 ± 54 aa |
| Standard deviation of domain lengths | 53.57 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 77.28 |
| Assigned Pfam label(s) | CL0287- PF05342- CL0159- PF07581 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484F736 | 31-330 | DGDGTVENPYQIKTADQLNDVRNNLTAHYVLIEDINLTGTAYENNWAPIGKYNFEFKGTFEGNNHKIENLKIQTTTNNGGFFGSAID… |
| R6DFU4 | 6-281 | DWQSLNGSGDFPYEIDFDGDSHVIKNFECSAGDYPSFFGVLCGDCRNVGFVDASVSSTRQGIGIITGYLGLKDKGNGSKTGRIVNCF… |
| A0A7G2M8N7 | 31-388 | None |
| A0A3R6LT81 | 872-1198 | None |
| A0A843D3L9 | 28-392 | None |
| A0A843DMA0 | 542-817 | None |
| A0A444VUF6 | 200-479 | None |
| A0A2V2E6G5 | 9-288 | None |
| A0A6M6DZT2 | 34-398 | None |
| A0A1C6JE89 | 55-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.