DPCstruct | MC1431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857NAU2 | 158-218 | TTTPDDPNCLIKGNINTKTGEKIYYFPGCISYNRTIVDKDLGESWFCSEIEARQSGFRKAL |
| A0A0T2MD34 | 16-77 | TISPASAQNGECNIKGNVSTQGERIYHMPGDKYYDETRISASHGERWFCTEAEARQAGWRRA |
| A0A5J6SSN7 | 247-302 | None |
| A0A0G1NTD5 | 86-144 | None |
| A0A1F5EKG5 | 253-312 | None |
| A0A7V9HA70 | 268-331 | None |
| F8JD25 | 335-387 | None |
| A0A2N5YPP1 | 5-70 | None |
| A0A0S6VVI4 | 247-310 | None |
| A0A2G2N474 | 312-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.