DPCstruct | MC14305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445EB34 | 21-98 | VEITLFPNDPLRLKDVFERLTSLRGSGIPLQYSWSCKRNYKSGYVWCDLALNDIIHPAEGAKYILKGSELVQASSGYS |
| A0A446SCS8 | 3-96 | LAQHPHQPLRLKDVMDKLTLLRGKGMPALFSWSCKRNYKNGYVWNDLSESDVIYPSDGVEYVLKGSEIFPGCSSGNHHANPSPSLTC… |
| A0A2K1IYX3 | 56-150 | None |
| A0A453RSD0 | 20-107 | None |
| A0A438G1J9 | 160-257 | None |
| A0A0A9CW32 | 3-76 | None |
| A0A540M8S5 | 23-107 | None |
| A0A835IX79 | 6-91 | None |
| A0A453FNZ7 | 1-83 | None |
| N1R1D2 | 5-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.