DPCstruct | MC14303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 424 ± 44 aa |
| Standard deviation of domain lengths | 44.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18596 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409VEM2 | 94-485 | LHRLLYRGSLSLPDSQLLLDGITFAARLDSPSKHGSFNLLENPLALALESMRGRPTLRFLGTVQLKDVYLDESGGVIMDIHPCASLS… |
| A0A150VFW7 | 1-459 | MMGALWTGSIFVEAGSVIEDIELSSSSNTDSIISRDAVLRLLSVVEVDRIPTYLVLGASFQVKTTNPKTEAWFRNYLLALGDGTEAE… |
| K2SFA7 | 1-473 | None |
| A0A1V8V3Z2 | 151-568 | None |
| A0A317XRM6 | 1-475 | None |
| A0A401GFB5 | 3-361 | None |
| L8WZ45 | 521-988 | None |
| A0A286UU20 | 46-460 | None |
| M5EE22 | 2-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.