DPCstruct | MC14302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 257 ± 56 aa |
| Standard deviation of domain lengths | 55.69 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1HJ96 | 6-315 | WDSNTVTAFAAVLLAAAAFIVAFLQVILEYMSSSTTRNLCSPQAIGVSAHQTKYSWNFGSWKLRVFYPLIKMDTGTLLLLFMSSEQR… |
| A0A150V700 | 1-250 | MADAAAILGIVYLVISLIALVLGVLSTITSYASTADGYRRCKESIMGPWGRATHRIWTFDEFRLKVMFLSPVIFVARPSNTRGPIKG… |
| A0A395T1J5 | 13-343 | None |
| N4UTB9 | 371-549 | None |
| A0A0C3GPI9 | 37-340 | None |
| X0AJM7 | 1-290 | None |
| A0A2J6QJW1 | 1-309 | None |
| U7PNM0 | 16-302 | None |
| A0A074Y657 | 33-222 | None |
| A0A420YMU3 | 149-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.