DPCstruct | MC14301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 98 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05730 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2QA11 | 178-274 | MKKGIVFGLGGLVGLCAAQEIPGLADLPECGQFCINAMQGSTIAEQLGCNQGDLGCLCRQQDFIYGVRDCSFQSCFGEGEADSVLSF… |
| A0A150V0L6 | 1-107 | MKTFVLLAASAAWAAAQDLSSLPACGQTCINNMIGLAQSQMGCASGDVSCYCSKPDFGYGVRDCSDQACSNSQQAESVISFGSSYCA… |
| J3NSL5 | 1-106 | None |
| A0A2V1BD27 | 76-169 | None |
| A0A3D8QG71 | 35-131 | None |
| A0A175WI45 | 4-122 | None |
| A0A6A5W0C0 | 341-438 | None |
| A0A409WNS5 | 36-122 | None |
| F2DLJ8 | 1-89 | None |
| A0A6A5VM75 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.