DPCstruct | MC1430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 18.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0QX47 | 668-786 | KMLVNIGDRPVSVEPTMNQVLIKDKGLEVKTDEVMIKENVLSVGGVDVKMSASEVTEKLNLVPKTIELKEDNAKAVYSMKINEQRKL… |
| A0A1F5JVR2 | 20-175 | PITRSYLDGKSDVQGVTSSKNVRLVAEGSEKGFVSGRDGAVSTLSLSQDQKSGTIKASTSVGEKEVAVLPDSAIKNTLASKVMSYVT… |
| A0A256Y9J4 | 142-316 | None |
| A0A349FVJ3 | 156-306 | None |
| A0A1F7Z2Y0 | 69-237 | None |
| A0A7C1SCY8 | 195-331 | None |
| A0A0B3B7P3 | 438-572 | None |
| A0A497SEV7 | 24-150 | None |
| A0A5E4K0T5 | 29-194 | None |
| A0A7C5RD80 | 531-656 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.